Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PTEN upstream open reading frame MP31 (MP31)

This Recombinant Human PTEN upstream open reading frame MP31 (MP31) spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTEN upstream open reading frame MP31; Micropeptide 31; Mitochondrial lactate dehydrogenase regulator; MLDHR MP31

UniProt

C0HLV8

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]
CL007A 1 mg

Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]

Sign In for Pricing
View Details
FKBP15 (NM_015258) Human Recombinant Protein
TP315853 20 µg

FKBP15 (NM_015258) Human Recombinant Protein

Sign In for Pricing
View Details
Cloprednol
TRC-C587295-10MG 10 mg

Cloprednol

Sign In for Pricing
View Details
MCF2 (NM_001171878) Human Over-expression Lysate
LC433549 20 µg

MCF2 (NM_001171878) Human Over-expression Lysate

Sign In for Pricing
View Details
Benzyl 2-Deoxy-2-acetamido-3,6-di-O-benzyl-4-(2’-deoxy-2’-acetamido-3’,6”-O-diacetyl-4’-deoxy-Beta-D-glucopyranosyl)-Beta-D-glucopyranoside
TRC-B222618-1MG 1 mg

Benzyl 2-Deoxy-2-acetamido-3,6-di-O-benzyl-4-(2’-deoxy-2’-acetamido-3’,6”-O-diacetyl-4’-deoxy-Beta-D-glucopyranosyl)-Beta-D-glucopyranoside

Sign In for Pricing
View Details
Weak acid and alkali Chemical storage cabinet BCBT-101
BCBT-101 Each

Weak acid and alkali Chemical storage cabinet BCBT-101

Sign In for Pricing
View Details