Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial

This Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial spans the amino acid sequence from region 332-457. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNK3/IPCEF1 fusion protein CNK3/IPCEF1

UniProt

G9CGD6

Expression Region

332-457

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGI2 Antibody (Biotin)
orb415168-01 50 µg

MAGI2 Antibody (Biotin)

Sign In for Pricing
View Details
MAGI2 Antibody (Biotin)
orb415168-02 100 µg

MAGI2 Antibody (Biotin)

Sign In for Pricing
View Details
Anti-Hsp90 beta/HSP90AB1 Antibody Picoband® (monoclonal, 7B7F5), Carrier-free
M01692-4-carrier-free 100 µg/Vial

Anti-Hsp90 beta/HSP90AB1 Antibody Picoband® (monoclonal, 7B7F5), Carrier-free

Sign In for Pricing
View Details
Insulin (INS) BioAssayTM ELISA Kit (Bovine) discontinued
025829-01 48 Tests

Insulin (INS) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
Insulin (INS) BioAssayTM ELISA Kit (Bovine) discontinued
025829-02 96 Tests

Insulin (INS) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
PQBP1 (NM_001032381) Human Over-expression Lysate
LC422317 20 µg

PQBP1 (NM_001032381) Human Over-expression Lysate

Sign In for Pricing
View Details