Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pde9a Antibody
orb864160 2 mg

Pde9a Antibody

Sign In for Pricing
View Details
Phospho-JNK1/2/3-T183/T183/T221 Rabbit mAb
E45R13101N-100 100 µL

Phospho-JNK1/2/3-T183/T183/T221 Rabbit mAb

Sign In for Pricing
View Details
EFNA2 Protein Vector (Mouse) (pPB-N-His)
PV174675 500 ng

EFNA2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-CD45/PTPRC (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134747 100 µL

Anti-CD45/PTPRC (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details
MRPL17 CRISPR All-in-one AAV vector set (with saCas9)(Human)
30448151 3x 1.0 µg DNA

MRPL17 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Chromogranin A (ABT037) Antibody (Ready to Use)
V0260R-01 3 mL

Chromogranin A (ABT037) Antibody (Ready to Use)

Sign In for Pricing
View Details