Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choriogonadotropin subunit beta 7 (CGB7)

This Recombinant Human Choriogonadotropin subunit beta 7 (CGB7) spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choriogonadotropin subunit beta 7 CGB7

UniProt

P0DN87

Expression Region

21-165

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7, Human, clone HB2H
MBS584945-01 0.1 mg

C7, Human, clone HB2H

Sign In for Pricing
View Details
C7, Human, clone HB2H
MBS584945-02 5x 0.1 mg

C7, Human, clone HB2H

Sign In for Pricing
View Details
EZM 2302 10mg
A19484-10 10 mg

EZM 2302 10mg

Sign In for Pricing
View Details
CCBP2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0372702 1.0 µg DNA

CCBP2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ALG2, ID (ALG2, Alpha-1,3/1,6-mannosyltransferase ALG2, Asparagine-linked glycosylation protein 2 homolog, GDP-Man:Man (1) GlcNAc (2) -PP-Dol alpha-1,3-mannosyltransferase, GDP-Man:Man (1) GlcNAc (2) -PP-dolichol mannosyltransferase, GDP-Man:Man (2) GlcNAc (2) -PP-Dol alpha-1,6-mannosyltransferase) (FITC) discontinued
031791-FITC 200 µL

ALG2, ID (ALG2, Alpha-1,3/1,6-mannosyltransferase ALG2, Asparagine-linked glycosylation protein 2 homolog, GDP-Man:Man (1) GlcNAc (2) -PP-Dol alpha-1,3-mannosyltransferase, GDP-Man:Man (1) GlcNAc (2) -PP-dolichol mannosyltransferase, GDP-Man:Man (2) GlcNAc (2) -PP-Dol alpha-1,6-mannosyltransferase) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)
MBS1137542-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR127W (YHR127W)

Sign In for Pricing
View Details