Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUR77 Rabbit mAb
MBS9467191-01 0.05 mL

NUR77 Rabbit mAb

Sign In for Pricing
View Details
NUR77 Rabbit mAb
MBS9467191-02 0.1 mL

NUR77 Rabbit mAb

Sign In for Pricing
View Details
NUR77 Rabbit mAb
MBS9467191-03 5x 0.1 mL

NUR77 Rabbit mAb

Sign In for Pricing
View Details
SLC36A2 Protein Vector (Mouse) (pPM-C-His)
PV230693 500 ng

SLC36A2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Aaas Mouse qPCR Template Standard (NM_153416)
MK204548 1 Kit

Aaas Mouse qPCR Template Standard (NM_153416)

Sign In for Pricing
View Details
2- (Pyrrolidin-1-yl) isonicotinaldehyde
OR8674-01 50 mg

2- (Pyrrolidin-1-yl) isonicotinaldehyde

Sign In for Pricing
View Details