Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 45 (ZNF45)

This Recombinant Human Zinc finger protein 45 (ZNF45) spans the amino acid sequence from region 1-682. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 45; BRC1744; Zinc finger protein 13; Zinc finger protein KOX5; ZNF45 KOX5 ZNF13

UniProt

Q02386

Expression Region

1-682

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKMATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDACGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVHCRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA19 (NM_174927) Human Over-expression Lysate
LC406408 20 µg

SPATA19 (NM_174927) Human Over-expression Lysate

Sign In for Pricing
View Details
Serpinc1 (NM_080844) Mouse Tagged ORF Clone
MG207423 10 µg

Serpinc1 (NM_080844) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human EMC8 siRNA
abx901714-01 15 nmol

Human EMC8 siRNA

Sign In for Pricing
View Details
Human EMC8 siRNA
abx901714-02 30 nmol

Human EMC8 siRNA

Sign In for Pricing
View Details
Cat Origin Component Rapid Test Kit
SC-DWCF-010 20 Tests/Box

Cat Origin Component Rapid Test Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase-2 Antibody
NBP2-26612-0.1mg 0.1 mg

Rabbit Polyclonal Caspase-2 Antibody

Sign In for Pricing
View Details