Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1A2 (OR1A2), partial

This Recombinant Human Olfactory receptor 1A2 (OR1A2), partial spans the amino acid sequence from region 159-195. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 1A2; Olfactory receptor 17-6; OR17-6; Olfactory receptor OR17-10; OR1A2

UniProt

Q9Y585

Expression Region

159-195

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NRXN3 Antibody Picoband®, Carrier-free
A05791-1-carrier-free 100 µg/Vial

Anti-NRXN3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Recombinant Human COL9A2 Protein
E30P1737 20 µg

Recombinant Human COL9A2 Protein

Sign In for Pricing
View Details
NAT13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1393205 3x 1.0 µg

NAT13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Proopiomelanocortin (POMC) ELISA Kit
RD-POMC-Mu-48Tests 48 Tests

Mouse Proopiomelanocortin (POMC) ELISA Kit

Sign In for Pricing
View Details
pCMV-EGFP-KCNJ10-Neo Plasmid
PVT54295 2 µg

pCMV-EGFP-KCNJ10-Neo Plasmid

Sign In for Pricing
View Details
mmu-miR-652-3p miRNA Mimic
MBS8300958-01 5 nmol

mmu-miR-652-3p miRNA Mimic

Sign In for Pricing
View Details