Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BTB/POZ domain-containing protein KCTD3 (KCTD3), partial

This Recombinant Human BTB/POZ domain-containing protein KCTD3 (KCTD3), partial spans the amino acid sequence from region 18-87. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTB/POZ domain-containing protein KCTD3; Renal carcinoma antigen NY-REN-45; KCTD3

UniProt

Q9Y597

Expression Region

18-87

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETGAIFIDRDPAAFAPILNFLRTKELDLRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BI-7273 25mg
A16068-25 25 mg

BI-7273 25mg

Sign In for Pricing
View Details
Phospho-Smad1 (Ser463/Ser465) (15L6) Rabbit Monoclonal Antibody
E28M3119 100 µL

Phospho-Smad1 (Ser463/Ser465) (15L6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
2-[ (4-Bromo-3-fluoro-phenylamino) -methylene]-malonic acid diethyl ester
PC109884-01 250 mg

2-[ (4-Bromo-3-fluoro-phenylamino) -methylene]-malonic acid diethyl ester

Sign In for Pricing
View Details
2-[ (4-Bromo-3-fluoro-phenylamino) -methylene]-malonic acid diethyl ester
PC109884-02 1 g

2-[ (4-Bromo-3-fluoro-phenylamino) -methylene]-malonic acid diethyl ester

Sign In for Pricing
View Details
2-[ (4-Bromo-3-fluoro-phenylamino) -methylene]-malonic acid diethyl ester
PC109884-03 5 g

2-[ (4-Bromo-3-fluoro-phenylamino) -methylene]-malonic acid diethyl ester

Sign In for Pricing
View Details
Rat SVCAM-1 (Soluble Vascuolar Cell Adhesion Molecule 1) ELISA Kit
EKF58351 96 Tests

Rat SVCAM-1 (Soluble Vascuolar Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details