Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyrin domain-containing protein 5 (PYDC5)

This Recombinant Human Pyrin domain-containing protein 5 (PYDC5) spans the amino acid sequence from region 1-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyrin domain-containing protein 5; Pyrin domain-only protein 3; PYDC5 POP3

UniProt

W6CW81

Expression Region

1-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCSEEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 RBD (Omicron_BF.7) Protein, C-His
MBS1577672-01 0.1 mg

Recombinant SARS-CoV-2 RBD (Omicron_BF.7) Protein, C-His

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 RBD (Omicron_BF.7) Protein, C-His
MBS1577672-02 1 mg

Recombinant SARS-CoV-2 RBD (Omicron_BF.7) Protein, C-His

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 RBD (Omicron_BF.7) Protein, C-His
MBS1577672-03 5x 1 mg

Recombinant SARS-CoV-2 RBD (Omicron_BF.7) Protein, C-His

Sign In for Pricing
View Details
5-Hydroxy-UTP
B8060-.01 10 µL (100 mM)

5-Hydroxy-UTP

Sign In for Pricing
View Details
Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2
C063-10ug 10 µg

Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2

Sign In for Pricing
View Details
Hsa-miR-649 miRNA Agomir
orb1921132-01 5 nmol

Hsa-miR-649 miRNA Agomir

Sign In for Pricing
View Details