Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab13 (NM_026677) Mouse Tagged ORF Clone
MG202075 10 µg

Rab13 (NM_026677) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Caffeic Acid-13C3
TRC-C080002-1MG 1 mg

Caffeic Acid-13C3

Sign In for Pricing
View Details
MBP, AlpHcAbs® Rabbit antibody (HRP)
HA710085 100 µg

MBP, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
1'-Deoxyguanosine Monohydrate-1’-d
TRC-D239556-1MG 1 mg

1'-Deoxyguanosine Monohydrate-1’-d

Sign In for Pricing
View Details
ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF647 conjugate, 0.1mg/mL
BNC471801-500 1x 500 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(+)-Citramalic Acid
TRC-C520525-10MG 10 mg

(+)-Citramalic Acid

Sign In for Pricing
View Details