Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACLY Rabbit Monoclonal Antibody [Clone ID: 23GB1620]
TA424540 100 µL

ACLY Rabbit Monoclonal Antibody [Clone ID: 23GB1620]

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (rPTPRC/1132), CF405S conjugate, 0.1mg/mL
BNC043461-500 1x 500 µL

CD45RB (B-Cell Marker) (rPTPRC/1132), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)
PKSH033665-01 10 µg

Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)

Sign In for Pricing
View Details
Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)
PKSH033665-02 50 µg

Recombinant Human CGA&CGB3 Heterodimer Protein (His & Flag Tag)

Sign In for Pricing
View Details
Human IL-1ra/IL-1F3 Antibody Pair Set
E-KAB-0478 50 µL & 100 µg

Human IL-1ra/IL-1F3 Antibody Pair Set

Sign In for Pricing
View Details
KIAA0513 (NM_001286565) Human Tagged ORF Clone
RG238049 10 µg

KIAA0513 (NM_001286565) Human Tagged ORF Clone

Sign In for Pricing
View Details