Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(Aminocarbonyl)-1-(2,3,5-tri-O-acetyl-beta-D-ribofuranosyl)-pyridinium Triflate
TRC-A794877-1G 1 g

3-(Aminocarbonyl)-1-(2,3,5-tri-O-acetyl-beta-D-ribofuranosyl)-pyridinium Triflate

Sign In for Pricing
View Details
Pribolab® Ultra Mycotoxin Derivatization Units
HWEQ-UMDU 1021 1 Unit

Pribolab® Ultra Mycotoxin Derivatization Units

Sign In for Pricing
View Details
Cycloheximide
A8244-5.1 10 mM (in 1mL DMSO)

Cycloheximide

Sign In for Pricing
View Details
FZD9 Peptide - N-terminal region (AAP41252)
AAP41252-100UG 100 µg

FZD9 Peptide - N-terminal region (AAP41252)

Sign In for Pricing
View Details
CHST4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
16146156 3x 1.0 µg DNA

CHST4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
3-Methanesulfonylazocane hydrochloride
RPD14184-01 50 mg

3-Methanesulfonylazocane hydrochloride

Sign In for Pricing
View Details