Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861) spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR7 (Toll Like Receptor 7) BioAssayTM ELISA Kit (Mouse) discontinued
384655 96 Tests

TLR7 (Toll Like Receptor 7) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Kakadu Plum Extract: 10:1
EXTW-154 1 Kg

Kakadu Plum Extract: 10:1

Sign In for Pricing
View Details
BAG5 Antibody
orb1327026 100 µg

BAG5 Antibody

Sign In for Pricing
View Details
HS1BP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
23907111 3x 1.0 µg

HS1BP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Tert-Butyl N-{[methyl (pyridin-2-ylmethyl) carbamoyl]methyl}carbamate
IAC64976-01 250 mg

Tert-Butyl N-{[methyl (pyridin-2-ylmethyl) carbamoyl]methyl}carbamate

Sign In for Pricing
View Details
Tert-Butyl N-{[methyl (pyridin-2-ylmethyl) carbamoyl]methyl}carbamate
IAC64976-02 2.5 g

Tert-Butyl N-{[methyl (pyridin-2-ylmethyl) carbamoyl]methyl}carbamate

Sign In for Pricing
View Details