Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861) spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium novyi ATP synthase subunit c (atpE)
MBS1016557 Inquire

Recombinant Clostridium novyi ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
VPS29 Antibody
orb1246792 0.1 mg

VPS29 Antibody

Sign In for Pricing
View Details
IFT43 Rabbit Polyclonal Antibody
E28PN6121 100 µL

IFT43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRMS1L (NM_032352) Human Tagged ORF Clone Lentiviral Particle
RC202645L4V 200 µL

BRMS1L (NM_032352) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cat Presynaptic Membrane Antibody ELISA Kit
MBS092168 Inquire

Cat Presynaptic Membrane Antibody ELISA Kit

Sign In for Pricing
View Details
Prl3d2 sgRNA CRISPR Lentivector set (Mouse)
K3080001 3x 1.0 µg

Prl3d2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details