Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAN ORF Vector (Human) (pORF)
ORF015211 1.0 µg DNA

ACAN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Barhl1 shRNA (UAS) - Lentiviral mouse Barhl1 shRNA (UAS) (25)
GTR15291329 1 Vial

Lentiviral mouse Barhl1 shRNA (UAS) - Lentiviral mouse Barhl1 shRNA (UAS) (25)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD9 Antibody
JOT22613F 20Tests

PE/Cyanine5 Anti-Human CD9 Antibody

Sign In for Pricing
View Details
Ranaconitine
AB1608 20 mg

Ranaconitine

Sign In for Pricing
View Details
4-Methyl-6- (trifluoromethyl) pyridine-3-sulfonyl chloride
FZC69386-01 50 mg

4-Methyl-6- (trifluoromethyl) pyridine-3-sulfonyl chloride

Sign In for Pricing
View Details
4-Methyl-6- (trifluoromethyl) pyridine-3-sulfonyl chloride
FZC69386-02 0.5 g

4-Methyl-6- (trifluoromethyl) pyridine-3-sulfonyl chloride

Sign In for Pricing
View Details