Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54) spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-beta Tubulin antibody
SLM-52290R-01 50 µL

Rabbit Anti-beta Tubulin antibody

Sign In for Pricing
View Details
Rabbit Anti-beta Tubulin antibody
SLM-52290R-02 100 µL

Rabbit Anti-beta Tubulin antibody

Sign In for Pricing
View Details
Beta-pinene
TBW01315 0.2ml

Beta-pinene

Sign In for Pricing
View Details
Rat Synapsin I (SYN1) ELISA Kit
RD-SYN1-Ra-96Tests 96 Tests

Rat Synapsin I (SYN1) ELISA Kit

Sign In for Pricing
View Details
Other HCy ELISA Kit (Ready to Use)
orb549564-01 48 Tests

Other HCy ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Other HCy ELISA Kit (Ready to Use)
orb549564-02 96 Tests

Other HCy ELISA Kit (Ready to Use)

Sign In for Pricing
View Details