Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54) spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15orf52 siRNA (m)
sc-141837 10 µM

C15orf52 siRNA (m)

Sign In for Pricing
View Details
Olr774 (NM_001000918) Rat Tagged Lenti ORF Clone
RR211322L3 10 µg

Olr774 (NM_001000918) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
STAT2 Recombinant Antibody, PE Conjugated
bsm-52234R-PE-TR 20 µL

STAT2 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Tmem250-ps shRNA (UAS) - Lentiviral mouse Tmem250-ps shRNA (UAS) (25)
GTR15166901 1 Vial

Lentiviral mouse Tmem250-ps shRNA (UAS) - Lentiviral mouse Tmem250-ps shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant (E.coli) C. perfringens beta toxin protein control for western blot
CPB12-C 100 ul

Recombinant (E.coli) C. perfringens beta toxin protein control for western blot

Sign In for Pricing
View Details
APEX1 Antibody
OABB01582-100UG 100 µg/Vial

APEX1 Antibody

Sign In for Pricing
View Details