Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 1-50 IGLV1-50

UniProt

A0A075B6I6

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INSL3 Antibody
PA1044 100 µg/Vial

Anti-INSL3 Antibody

Sign In for Pricing
View Details
(D-Phe7) -α-MSH
HY-P3659 1 Each

(D-Phe7) -α-MSH

Sign In for Pricing
View Details
VPS33B Rabbit pAb
orb2711888-01 50 µL

VPS33B Rabbit pAb

Sign In for Pricing
View Details
VPS33B Rabbit pAb
orb2711888-02 100 µL

VPS33B Rabbit pAb

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001001435) Human Tagged ORF Clone Lentiviral Particle
RC213959L3V 200 µL

Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001001435) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Biotin 0.4mM
40120733-1 10 mL

Biotin 0.4mM

Sign In for Pricing
View Details