Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 5-48 IGLV5-48

UniProt

A0A075B6I7

Expression Region

20-105

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)
MBS1055260 Inquire

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
CPVL (AB2261) Rabbit mAb
M3676-01 20 µL

CPVL (AB2261) Rabbit mAb

Sign In for Pricing
View Details
CPVL (AB2261) Rabbit mAb
M3676-02 50 μL

CPVL (AB2261) Rabbit mAb

Sign In for Pricing
View Details
CPVL (AB2261) Rabbit mAb
M3676-03 100 µL

CPVL (AB2261) Rabbit mAb

Sign In for Pricing
View Details
CPVL (AB2261) Rabbit mAb
M3676-04 200 µL

CPVL (AB2261) Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal E-Cadherin Antibody (967738) [DyLight 680]
FAB18383Y 0.1 mL

Mouse Monoclonal E-Cadherin Antibody (967738) [DyLight 680]

Sign In for Pricing
View Details