Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 5-48 IGLV5-48

UniProt

A0A075B6I7

Expression Region

20-105

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac Galanthamine Hydrobromide
464195 1 mg

Rac Galanthamine Hydrobromide

Sign In for Pricing
View Details
Recombinant Salmonella trpL Protein (aa 1-14)
VAng-Wyb0645-500gEcoli 500 µg (E. coli)

Recombinant Salmonella trpL Protein (aa 1-14)

Sign In for Pricing
View Details
5-Oxo-1-phenylpyrrolidine-3-carboxylic acid
sc-278297 200 mg

5-Oxo-1-phenylpyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
TCRS-417
MBS5822680 Inquire

TCRS-417

Sign In for Pricing
View Details
Fam63b AAV siRNA Pooled Vector
20074164 1.0 µg

Fam63b AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human c-Rel MAb (Clone 321422)
MAB4606 50 µg

Human c-Rel MAb (Clone 321422)

Sign In for Pricing
View Details