Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MYBPC1 Antibody [mFluor Violet 500 SE]
NBP2-41119MFV500 0.1 mL

Rabbit Polyclonal MYBPC1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)
TRV-0016070-01 20 µL

Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)
TRV-0016070-02 100 µL

Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)
TRV-0016070-03 200 µL

Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)
TRV-0016070-04 1 mL

Polyclonal Antibody to Interleukin 3 Receptor Alpha (IL3Ra)

Sign In for Pricing
View Details
Sheep WD repeat containing protein 1 (WDR1) ELISA Kit
GTR10327217 96 Well

Sheep WD repeat containing protein 1 (WDR1) ELISA Kit

Sign In for Pricing
View Details