Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP1, ID (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550) discontinued
039659-ML550 100 µL

PARP1, ID (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Hsa-miR-6878-3p miRNA Inhibitor
CIH2420-01 10 nmol

Hsa-miR-6878-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6878-3p miRNA Inhibitor
CIH2420-02 20 nmol

Hsa-miR-6878-3p miRNA Inhibitor

Sign In for Pricing
View Details
ASHH4 Antibody
orb784709 2 mg

ASHH4 Antibody

Sign In for Pricing
View Details
ALAS1 (5-aminolevulinate Synthase, Nonspecific, Mitochondrial, ALAS-H, 5-aminolevulinic Acid Synthase 1, ALAS3, ALASH, Delta-ALA Synthase 1, Delta-aminolevulinate Synthase 1, OK/SW-cl.121) (APC)
123186-APC 100 µL

ALAS1 (5-aminolevulinate Synthase, Nonspecific, Mitochondrial, ALAS-H, 5-aminolevulinic Acid Synthase 1, ALAS3, ALASH, Delta-ALA Synthase 1, Delta-aminolevulinate Synthase 1, OK/SW-cl.121) (APC)

Sign In for Pricing
View Details
NR2D Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1598033 100 µL

NR2D Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details