Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS18B Rabbit Polyclonal Antibody (Fluoro550)
orb3094324 100 µg

MRPS18B Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Lentiviral human RNGTT shRNA (UAS) - Lentiviral human RNGTT shRNA (UAS, RFP) plasmid
GTR15317584 1 Vial

Lentiviral human RNGTT shRNA (UAS) - Lentiviral human RNGTT shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
RECS1 discontinued
541671-01 30ul

RECS1 discontinued

Sign In for Pricing
View Details
RECS1 discontinued
541671-02 100 µL

RECS1 discontinued

Sign In for Pricing
View Details
ATXN1 (Ataxin-1, Spinocerebellar Ataxia Type 1 Protein, ATXN1, ATX1, SCA1) (MaxLight 405)
MBS6407878-01 0.1 mL

ATXN1 (Ataxin-1, Spinocerebellar Ataxia Type 1 Protein, ATXN1, ATX1, SCA1) (MaxLight 405)

Sign In for Pricing
View Details
ATXN1 (Ataxin-1, Spinocerebellar Ataxia Type 1 Protein, ATXN1, ATX1, SCA1) (MaxLight 405)
MBS6407878-02 5x 0.1 mL

ATXN1 (Ataxin-1, Spinocerebellar Ataxia Type 1 Protein, ATXN1, ATX1, SCA1) (MaxLight 405)

Sign In for Pricing
View Details