Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spleen Extract, Bovine
MBS639342-01 1 mL

Spleen Extract, Bovine

Sign In for Pricing
View Details
Spleen Extract, Bovine
MBS639342-02 5x 1 mL

Spleen Extract, Bovine

Sign In for Pricing
View Details
CD28 (T-cell-specific surface glycoprotein CD28, Tp44)
168681-01 20 µg

CD28 (T-cell-specific surface glycoprotein CD28, Tp44)

Sign In for Pricing
View Details
CD28 (T-cell-specific surface glycoprotein CD28, Tp44)
168681-02 100 µg

CD28 (T-cell-specific surface glycoprotein CD28, Tp44)

Sign In for Pricing
View Details
Lipoic Acid Impurity 42
RM-L091668-01 10 mg

Lipoic Acid Impurity 42

Sign In for Pricing
View Details
Lipoic Acid Impurity 42
RM-L091668-02 25 mg

Lipoic Acid Impurity 42

Sign In for Pricing
View Details