Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 2-18 (LV218)

This Recombinant Human Immunoglobulin lambda variable 2-18 (LV218) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 2-18 IGLV2-18

UniProt

A0A075B6J9

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to BLK
sAP-0067 50 µg

Mouse Monoclonal Antibody to BLK

Sign In for Pricing
View Details
AES, CT (Amino-terminal Enhancer of Split, GRG, ESP1, TLE5)
A0921-80 100 µg

AES, CT (Amino-terminal Enhancer of Split, GRG, ESP1, TLE5)

Sign In for Pricing
View Details
MYO15A Antibody
MBS7136442-01 0.05 mL

MYO15A Antibody

Sign In for Pricing
View Details
MYO15A Antibody
MBS7136442-02 0.1 mL

MYO15A Antibody

Sign In for Pricing
View Details
MYO15A Antibody
MBS7136442-03 5x 0.1 mL

MYO15A Antibody

Sign In for Pricing
View Details
MCAF, Human (Monocyte Chemotactic Activating Factor) BioAssayTM ELISA Kit
M2690-17 96 Tests

MCAF, Human (Monocyte Chemotactic Activating Factor) BioAssayTM ELISA Kit

Sign In for Pricing
View Details