Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-10 (LV310)

This Recombinant Human Immunoglobulin lambda variable 3-10 (LV310) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-10 IGLV3-10

UniProt

A0A075B6K4

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMP3 (NM_001425) Human Tagged Lenti ORF Clone
RC202216L4 10 µg

EMP3 (NM_001425) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Red Bean Extract
E3283-5mg 5 mg

Red Bean Extract

Sign In for Pricing
View Details
SOCS-1 siRNA (h)
sc-40996 10 µM

SOCS-1 siRNA (h)

Sign In for Pricing
View Details
Gpr39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
22564116 3x 1.0 µg

Gpr39 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ONECUT1 ORF Vector (Human) (pORF)
34819011 1.0 µg DNA

ONECUT1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Thiazole synthase (thiG)
MBS1233138-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Thiazole synthase (thiG)

Sign In for Pricing
View Details