Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)

This Recombinant Human Immunoglobulin lambda variable 3-9 (LV39) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-9 IGLV3-9

UniProt

A0A075B6K5

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1 Rabbit Monoclonal Antibody [KD Validation]
E51K62581 40 µL

FOXO1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Lith-O-Asp
MBS5753417 Inquire

Lith-O-Asp

Sign In for Pricing
View Details
Donkey Caspase 12 ELISA Kit
MBS083433 Inquire

Donkey Caspase 12 ELISA Kit

Sign In for Pricing
View Details
Rat Cyclin J (CCNJ) ELISA Kit
GTR10331041 96 Well

Rat Cyclin J (CCNJ) ELISA Kit

Sign In for Pricing
View Details
NMNAT2 Rabbit Polyclonal Antibody (PE)
orb489473 100 µL

NMNAT2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
HP1 alpha Antibody
abx012958-01 10 µg

HP1 alpha Antibody

Sign In for Pricing
View Details