Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-3 (LV403)

This Recombinant Human Immunoglobulin lambda variable 4-3 (LV403) spans the amino acid sequence from region 20-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-3 IGLV4-3

UniProt

A0A075B6K6

Expression Region

20-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPVLTQPPSASALLGASIKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTFSNLQSDDEAEYHCGESHTIDGQVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOCK11 sgRNA CRISPR Lentivector (Human) (Target 3)
K0624604 1.0 µg DNA

DOCK11 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
C. difficile GDH
10CDG10D 20 Tests

C. difficile GDH

Sign In for Pricing
View Details
Alg11 ORF Vector (Mouse) (pORF)
11757014 1.0 µg DNA

Alg11 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZMYND11 Recombinant Protein (Rat)
RP238748 100 µg

ZMYND11 Recombinant Protein (Rat)

Sign In for Pricing
View Details
IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: LBI3F6]
AMM21638VCF 100 µg

IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: LBI3F6]

Sign In for Pricing
View Details
Keratin 12 (KRT12) (NM_000223) Human Over-expression Lysate
LH02817V 100 µg

Keratin 12 (KRT12) (NM_000223) Human Over-expression Lysate

Sign In for Pricing
View Details