Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-3 (LV403)

This Recombinant Human Immunoglobulin lambda variable 4-3 (LV403) spans the amino acid sequence from region 20-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-3 IGLV4-3

UniProt

A0A075B6K6

Expression Region

20-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPVLTQPPSASALLGASIKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTFSNLQSDDEAEYHCGESHTIDGQVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Or51b4 qPCR Primer Pair
QM18302S 200 Tests

Mouse Or51b4 qPCR Primer Pair

Sign In for Pricing
View Details
BRD4 (NM_058243) Human Tagged Lenti ORF Clone
RC218845L2 10 µg

BRD4 (NM_058243) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Unc45b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4072708 1.0 µg DNA

Unc45b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
EWSR1 gene break apart probe
FP-051 K Fast probe 100 μL (10-20T), DAPI Staining solution (20T)

EWSR1 gene break apart probe

Sign In for Pricing
View Details
USE1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV716636 1.0 µg DNA

USE1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
LETM1 AAV Vector (Rat) (CMV)
26452106 1 µg

LETM1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details