Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11)

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11) spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nfkbiz (NM_030612) Mouse Tagged Lenti ORF Clone
MR222336L4 10 µg

Nfkbiz (NM_030612) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
JW 67, Wnt pathway Inhibitor (Induces Degradation of Active B-catenin, Trispiro[3H-indole-3,2'-[1,3]dioxane­-2'',3'''-[3H]indole]-2,2''' (1H,1'''H) -dione)
145679 10 mg

JW 67, Wnt pathway Inhibitor (Induces Degradation of Active B-catenin, Trispiro[3H-indole-3,2'-[1,3]dioxane­-2'',3'''-[3H]indole]-2,2''' (1H,1'''H) -dione)

Sign In for Pricing
View Details
Lentiviral human TMEM170B sgRNA gene knockout kit - Lentiviral human TMEM170B sgRNA gene knockout kit (plasmid)
GTR15371615 1 Vial

Lentiviral human TMEM170B sgRNA gene knockout kit - Lentiviral human TMEM170B sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CCA1 Protein Lysate (Human) with C-Ha Tag
15156031 100 µg

CCA1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
APOBEC3G, CT (DNA dC->dU-editing Enzyme APOBEC-3G, APOBEC-related Cytidine Deaminase, ARCD, APOBEC-related Protein, ARP-9, APOBEC-related Protein 9, CEM15, CEM-15, MDS019) discontinued
A2298-90N 50 µg

APOBEC3G, CT (DNA dC->dU-editing Enzyme APOBEC-3G, APOBEC-related Cytidine Deaminase, ARCD, APOBEC-related Protein, ARP-9, APOBEC-related Protein 9, CEM15, CEM-15, MDS019) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) FITC
DL87075A-01 100 µL

Rabbit Anti-Bovine IgG (H&L) FITC

Sign In for Pricing
View Details