Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11)

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11) spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Chloride 20%
40120414-1 500 mL

Sodium Chloride 20%

Sign In for Pricing
View Details
BTAF1 Protein Vector (Human) (pPB-N-His)
PV049394 500 ng

BTAF1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Histone H2A.Z/V Mouse Monoclonal Antibody
orb2957882-01 50 µg

Histone H2A.Z/V Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Histone H2A.Z/V Mouse Monoclonal Antibody
orb2957882-02 100 µg

Histone H2A.Z/V Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Histone H2A.Z/V Mouse Monoclonal Antibody
orb2957882-03 1 mg

Histone H2A.Z/V Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PRKACB CRISPRa sgRNA lentivector (set of three targets)(Rat)
37625126 3x 1.0µg DNA

PRKACB CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details