Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIP2A (Disco-interacting Protein 2 Homolog A, DIP2 Homolog A, C21orf106, DIP2, KIAA0184) (PE)
125853-PE 100 µL

DIP2A (Disco-interacting Protein 2 Homolog A, DIP2 Homolog A, C21orf106, DIP2, KIAA0184) (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal alpha-Taxilin Antibody
NBP2-56295 100 µL

Rabbit Polyclonal alpha-Taxilin Antibody

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Anillin (ANLN)
MBS2137676-01 0.1 mL

Biotin Linked Polyclonal Antibody to Anillin (ANLN)

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Anillin (ANLN)
MBS2137676-02 0.2 mL

Biotin Linked Polyclonal Antibody to Anillin (ANLN)

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Anillin (ANLN)
MBS2137676-03 0.5 mL

Biotin Linked Polyclonal Antibody to Anillin (ANLN)

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Anillin (ANLN)
MBS2137676-04 1 mL

Biotin Linked Polyclonal Antibody to Anillin (ANLN)

Sign In for Pricing
View Details