Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyrophosphatase 1 (PPA1) Human qPCR Primer Pair (NM_021129)
HP214064 200 Reactions

Pyrophosphatase 1 (PPA1) Human qPCR Primer Pair (NM_021129)

Sign In for Pricing
View Details
MitoPT™ TMRE & TMRM Kits
KF17359 500 Tests

MitoPT™ TMRE & TMRM Kits

Sign In for Pricing
View Details
NaCl, 0.9% (Sterile)
TSH-00526 500 mL

NaCl, 0.9% (Sterile)

Sign In for Pricing
View Details
Rabbit MYD88 (Myeloid Differentiation Factor 88) ValidElisa Kit
EK346708 96 Well

Rabbit MYD88 (Myeloid Differentiation Factor 88) ValidElisa Kit

Sign In for Pricing
View Details
CTXN3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
17131151 3x 1.0 µg DNA

CTXN3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
EHD2 HDR Plasmid (m)
sc-435199-HDR 20 µg

EHD2 HDR Plasmid (m)

Sign In for Pricing
View Details