Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1)

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPT1, CT (ANGPT1, KIAA0003, Angiopoietin-1) (Azide free) (HRP)
031872-HRP 200 µL

ANGPT1, CT (ANGPT1, KIAA0003, Angiopoietin-1) (Azide free) (HRP)

Sign In for Pricing
View Details
Claudin-5 Antibody [F16P13]
C21728-20uL 20 µL

Claudin-5 Antibody [F16P13]

Sign In for Pricing
View Details
SF1-set siRNA/shRNA/RNAi Lentivector (Human)
43561091 4x 500 ng

SF1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
AEBP2 Polyclonal Antibody
ANT-10113-100ug 100 µg

AEBP2 Polyclonal Antibody

Sign In for Pricing
View Details
FGFR4 (NM_213647) Human Over-expression Lysate
LY403876 100 µg

FGFR4 (NM_213647) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti ANXA5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul
IRBAMLANXA5AP808200UL 200 µL

Rabbit Anti ANXA5 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul

Sign In for Pricing
View Details