Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1)

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)
abx108325-01 20 µg

Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)
abx108325-02 50 µg

Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)
abx108325-03 100 µg

Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)
abx108325-04 200 µg

Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)
abx108325-05 1 mg

Guanine Nucleotide Binding Protein Subunit Beta 5 (GNB5) Antibody (HRP)

Sign In for Pricing
View Details
PCMV-3xHA-PAFAH1B2 (human) -Neo
BZ53461 1 Vial

PCMV-3xHA-PAFAH1B2 (human) -Neo

Sign In for Pricing
View Details