Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM122A (Family with Sequence Similarity 122A, C9orf42, MGC17347) (MaxLight 750) discontinued
245937-ML750 100 µL

FAM122A (Family with Sequence Similarity 122A, C9orf42, MGC17347) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KIAA0146 CRISPR Activation Plasmid (h2)
sc-411755-ACT-2 20 µg

KIAA0146 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
hsa-miR-4257 miRNA Inhibitor
MIH02203 2x 5.0 nmol

hsa-miR-4257 miRNA Inhibitor

Sign In for Pricing
View Details
6-Amino-4-methoxy-1- (2-deoxy-b-D-ribofuranosyl) -1H-pyrazolo[3,4-d]pyrimidine
orb1907967-01 5 mg

6-Amino-4-methoxy-1- (2-deoxy-b-D-ribofuranosyl) -1H-pyrazolo[3,4-d]pyrimidine

Sign In for Pricing
View Details
6-Amino-4-methoxy-1- (2-deoxy-b-D-ribofuranosyl) -1H-pyrazolo[3,4-d]pyrimidine
orb1907967-02 10 mg

6-Amino-4-methoxy-1- (2-deoxy-b-D-ribofuranosyl) -1H-pyrazolo[3,4-d]pyrimidine

Sign In for Pricing
View Details
6-Amino-4-methoxy-1- (2-deoxy-b-D-ribofuranosyl) -1H-pyrazolo[3,4-d]pyrimidine
orb1907967-03 25 mg

6-Amino-4-methoxy-1- (2-deoxy-b-D-ribofuranosyl) -1H-pyrazolo[3,4-d]pyrimidine

Sign In for Pricing
View Details