Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-28 (KV228)

This Recombinant Human Immunoglobulin kappa variable 2-28 (KV228) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-28 IGKV2-28

UniProt

A0A075B6P5

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (3-Ethyl-1-phenyl-1H-1,2,4-triazol-5-yl) -propanoic acid
sc-309713 500 mg

3- (3-Ethyl-1-phenyl-1H-1,2,4-triazol-5-yl) -propanoic acid

Sign In for Pricing
View Details
NKp30 Rabbit pAb
E2251919 100 µL

NKp30 Rabbit pAb

Sign In for Pricing
View Details
Anti-TDRKH Antibody
STJ503227 100 µg

Anti-TDRKH Antibody

Sign In for Pricing
View Details
WDSUB1 Protein Lysate (Mouse) with C-HA Tag
50391034 100 µg

WDSUB1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
UROS (NM_000375) Human Tagged Lenti ORF Clone
RC200385L3 10 µg

UROS (NM_000375) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Empagliflozin Impurity 205
RM-E131805-01 10 mg

Empagliflozin Impurity 205

Sign In for Pricing
View Details