Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C10orf4 (FRA10AC1) activation kit by CRISPRa
GA114677 1 Kit

Human C10orf4 (FRA10AC1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559217 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
HLA-DQ (MHC II) (HLA-DQA1/2866R), CF640R conjugate, 0.1mg/mL
BNC402866-500 1x 500 µL

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NEDD1 Antibody
R34894-100UG 100 µg

NEDD1 Antibody

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL
BNC881859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LKB1 (STK11) pSer334 Rabbit Polyclonal Antibody
AP20912PU-N 100 µg

LKB1 (STK11) pSer334 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details