Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPSE Antibody - middle region
ARP87170_P050-25UL 25 µL

HPSE Antibody - middle region

Sign In for Pricing
View Details
Mouse Monoclonal Breast cancer suppressor candidate 1 Antibody (OTI3D6) [Alexa Fluor 405]
NBP2-71158AF405 0.1 mL

Mouse Monoclonal Breast cancer suppressor candidate 1 Antibody (OTI3D6) [Alexa Fluor 405]

Sign In for Pricing
View Details
Human Carboxypeptidase E ELISA Kit (CPE)
RK01173 96 Tests

Human Carboxypeptidase E ELISA Kit (CPE)

Sign In for Pricing
View Details
RPL7P35 CRISPRa sgRNA lentivector (set of three targets)(Human)
41895121 3x 1.0µg DNA

RPL7P35 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Triticum aestivum Photosystem II D2 protein (psbD)
orb2914857-01 20 µg

Recombinant Triticum aestivum Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details
Recombinant Triticum aestivum Photosystem II D2 protein (psbD)
orb2914857-02 100 µg

Recombinant Triticum aestivum Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details