Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDG-7 Polyclonal Antibody
MBS9243483-01 0.1 mL

EDG-7 Polyclonal Antibody

Sign In for Pricing
View Details
EDG-7 Polyclonal Antibody
MBS9243483-02 5x 0.1 mL

EDG-7 Polyclonal Antibody

Sign In for Pricing
View Details
RNF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40285111 3x 1.0 µg

RNF2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ZNF566 (NM_001300970) Human Tagged ORF Clone
RG237382 10 µg

ZNF566 (NM_001300970) Human Tagged ORF Clone

Sign In for Pricing
View Details
OOCA01693-25T - Human TMED2 Primer Pair 1
OOCA01693-25T 25 Tests

OOCA01693-25T - Human TMED2 Primer Pair 1

Sign In for Pricing
View Details
PDE1B Antibody (YA7483, Rabbit)
HY-P87798 1 Each

PDE1B Antibody (YA7483, Rabbit)

Sign In for Pricing
View Details