Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S100a10 activation kit by CRISPRa
GA203743 1 Kit

Mouse S100a10 activation kit by CRISPRa

Sign In for Pricing
View Details
Nudt16l2 Mouse Gene Knockout Kit (CRISPR)
KN500161 1 Kit

Nudt16l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDX1 Mouse Monoclonal Antibody [Clone ID: OTI1C7]
CF810572 100 µg

CDX1 Mouse Monoclonal Antibody [Clone ID: OTI1C7]

Sign In for Pricing
View Details
ZFAND3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]
TA507382AM 100 µL

ZFAND3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details
5-Undecylresorcinol
TRC-U789250-1G 1 g

5-Undecylresorcinol

Sign In for Pricing
View Details
Pinoxaden
TRC-P469505-500MG 500 mg

Pinoxaden

Sign In for Pricing
View Details