Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-7-deaza-9-(2’,3’,5’-tri-O-acetyl-Beta-D-ribofuranoysyl)purine
TRC-C365187-50MG 50 mg

6-Chloro-7-deaza-9-(2’,3’,5’-tri-O-acetyl-Beta-D-ribofuranoysyl)purine

Sign In for Pricing
View Details
mAID tag Rabbit Polyclonal Antibody
ER1802-93 100 µL

mAID tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Chlorobenzeneboronic Acid
TRC-C364565-25G 25 g

4-Chlorobenzeneboronic Acid

Sign In for Pricing
View Details
Tab1 Mouse Gene Knockout Kit (CRISPR)
KN517117 1 Kit

Tab1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myo18a Mouse Gene Knockout Kit (CRISPR)
KN310624BN 1 Kit

Myo18a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEF2A (NM_005587) Human Recombinant Protein
TP312830 20 µg

MEF2A (NM_005587) Human Recombinant Protein

Sign In for Pricing
View Details