Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIMP1 antibody
OAGA00383-100UL 100 µL

AIMP1 antibody

Sign In for Pricing
View Details
Phospho-Ron (Tyr1238+Tyr1239) Polyclonal Antibody, PE-Cy5 Conjugated
bs-10118R-PE-Cy5 100 µL

Phospho-Ron (Tyr1238+Tyr1239) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Anti-Bacillus anthracis PAD4 Nanobody (VHH10)
JN898073-01 50 µg

Anti-Bacillus anthracis PAD4 Nanobody (VHH10)

Sign In for Pricing
View Details
Anti-Bacillus anthracis PAD4 Nanobody (VHH10)
JN898073-02 100 µg

Anti-Bacillus anthracis PAD4 Nanobody (VHH10)

Sign In for Pricing
View Details
Anti-Bacillus anthracis PAD4 Nanobody (VHH10)
JN898073-03 1 mg

Anti-Bacillus anthracis PAD4 Nanobody (VHH10)

Sign In for Pricing
View Details
Duck Protease Activated Receptor 2 ELISA Kit
MBS064266 Inquire

Duck Protease Activated Receptor 2 ELISA Kit

Sign In for Pricing
View Details