Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127)

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Annexin A8/ANXA8 Protein (His Tag)
PKSH030551 100 µg

Recombinant Human Annexin A8/ANXA8 Protein (His Tag)

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), 0.2mg/mL
BNUB3813-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), 0.2mg/mL

Sign In for Pricing
View Details
(3R)-3-Hydroxybutyric Acid-1-13C
TRC-H833028-5MG 5 mg

(3R)-3-Hydroxybutyric Acid-1-13C

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL
BNC471133-500 1x 500 µL

CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CENPVL2 activation kit by CRISPRa
GA118513 1 Kit

Human CENPVL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Eph receptor A2 (EPHA2) (NM_004431) Human Recombinant Protein
TP700138 20 µg

Eph receptor A2 (EPHA2) (NM_004431) Human Recombinant Protein

Sign In for Pricing
View Details