Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127)

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclo(L-prolyl-L-phenylalanyl)
TRC-C988180-250MG 250 mg

Cyclo(L-prolyl-L-phenylalanyl)

Sign In for Pricing
View Details
Rbsn Mouse Gene Knockout Kit (CRISPR)
KN520070 1 Kit

Rbsn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ProPette™ LE Single Channel Pipettor
P5200-100U 1 Each

ProPette™ LE Single Channel Pipettor

Sign In for Pricing
View Details
Mrpl52 (BC060043) Mouse Tagged ORF Clone
MG200041 10 µg

Mrpl52 (BC060043) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Scramblase 1 (PLSCR1) (NM_021105) Human Over-expression Lysate
LC402834 20 µg

Scramblase 1 (PLSCR1) (NM_021105) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Aminomorpholine-4-carbothioamide
TRC-A614458-25MG 25 mg

N-Aminomorpholine-4-carbothioamide

Sign In for Pricing
View Details