Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127)

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF405S conjugate, 0.1mg/mL
BNC043014-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), CF405S conjugate, 0.1mg/mL
BNC040781-100 1x 100 µL

Carbonic Anhydrase IX (CA9/781), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PNCK Human Gene Knockout Kit (CRISPR)
KN221855RB 1 Kit

PNCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HIF 2 alpha (EPAS1) Human Gene Knockout Kit (CRISPR)
KN208604RB 1 Kit

HIF 2 alpha (EPAS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF594 conjugate, 0.1mg/mL
BNC940896-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Hydroxyethanephosphonic Acid
TRC-H939650-25MG 25 mg

2-Hydroxyethanephosphonic Acid

Sign In for Pricing
View Details