Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30)

This Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-30 IGKV2D-30

UniProt

A0A075B6S6

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida albicans Candidapepsin-2 (SAP2)
CSB-EP505575CZE-01 20 µg

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Sign In for Pricing
View Details
Recombinant Candida albicans Candidapepsin-2 (SAP2)
CSB-EP505575CZE-02 100 µg

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Sign In for Pricing
View Details
Recombinant Candida albicans Candidapepsin-2 (SAP2)
CSB-EP505575CZE-03 1 mg

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Sign In for Pricing
View Details
BATF3 antibody - N-terminal region (ARP39372_P050)
ARP39372_P050 100 µL

BATF3 antibody - N-terminal region (ARP39372_P050)

Sign In for Pricing
View Details
FOXM1-TAG-Puro
LTV-0059-1S 5x10^6

FOXM1-TAG-Puro

Sign In for Pricing
View Details
Urocortin siRNA (h)
sc-39399 10 µM

Urocortin siRNA (h)

Sign In for Pricing
View Details