Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1-37 IGKV1-37

UniProt

A0A075B6S9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6.1-TTC25 Plasmid
PVT16015 2 µg

pCMV-SPORT6.1-TTC25 Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal c-jun Antibody (OTI2D11) [Alexa Fluor 405]
NBP2-71058AF405 0.1 mL

Mouse Monoclonal c-jun Antibody (OTI2D11) [Alexa Fluor 405]

Sign In for Pricing
View Details
TGase5 CRISPR Activation Plasmid (m2)
sc-428768-ACT-2 20 µg

TGase5 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
CXCR7 Antibody, mAb, Rabbit
A03069-100 100 µL

CXCR7 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
CD85j Rabbit pAb
A22548-01 100 μL

CD85j Rabbit pAb

Sign In for Pricing
View Details
CD85j Rabbit pAb
A22548-02 20 µL

CD85j Rabbit pAb

Sign In for Pricing
View Details