Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2)

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-01 20 µg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-02 100 µg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-03 500 µg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4/Nectin 4 protein (His tag)
PDMH100416-04 1 mg

Recombinant Human NECTIN4/Nectin 4 protein (His tag)

Sign In for Pricing
View Details
Mouse Aldh3a1 activation kit by CRISPRa
GA200159 1 Kit

Mouse Aldh3a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 1 (ACE) Rabbit Monoclonal Antibody
TA423283 100 µL

Angiotensin Converting Enzyme 1 (ACE) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details