Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2)

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gamma TubULin (TUBG1) Human Gene Knockout Kit (CRISPR)
KN400408 1 Kit

gamma TubULin (TUBG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lgals12 Rabbit Polyclonal Antibody
TA363397 100 µL

Lgals12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (SK3), CF®660C Conjugate - Biotium Choice
P001-660C-125 1x 125 µL

CD4 Mouse Monoclonal Antibody (SK3), CF®660C Conjugate - Biotium Choice

Sign In for Pricing
View Details
2,2',3,3',4',5,5'-Heptachloro-4-biphenylol
TRC-H294770-25MG 25 mg

2,2',3,3',4',5,5'-Heptachloro-4-biphenylol

Sign In for Pricing
View Details
1700013D24Rik Mouse Gene Knockout Kit (CRISPR)
KN500086 1 Kit

1700013D24Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF740 conjugate, 0.1mg/mL
BNC741143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details